notebook 🚀 - Kernel error in jupyter notebook

Kindly respond

Khushu06 on 23 Sep 2019

You might want to be sure the latest version (5.3.3) of jupyter_client is fully installed. Looks like this portion of its setup.py didn't run pywin32 >=1.0 ; sys_platform == 'win32'.

kevin-bates on 23 Sep 2019

It's 5.3.3 version only but there is no file = setup.py under jupyter _client. Kindle elaborate

Khushu06 on 23 Sep 2019

jupyter core : 4.5.0
jupyter-notebook : 6.0.1
qtconsole : 4.5.5
ipython : 7.8.0
ipykernel : 5.1.2
jupyter client : 5.3.3
jupyter lab : 1.1.3
nbconvert : 5.6.0
ipywidgets : 7.5.1
nbformat : 4.4.0
traitlets : 4.3.2

Khushu06 on 23 Sep 2019

I'm referring to the setup.py that's in the repository: https://github.com/jupyter/jupyter_client/blob/5.3.3/setup.py
This file isn't laid down during installation but it's what is used during jupyter_client's installation.

You might try pip install --upgrade jupyter_client. You should have pywin32 installed.

kevin-bates on 23 Sep 2019

👍16 ❤9 🎉6

I have installed anaconda , under that jupyter notebook also get installed .
I have 5.3.3 version and pywin32 is installed . Still there is kernel error.

Khushu06 on 23 Sep 2019

👍6

I have 5.3.3 version and pywin32 is installed . Still there is kernel error.

Is the kernel failure still due to a DLL load failure - or something different now?
ImportError: DLL load failed: The specified procedure could not be found.

kevin-bates on 23 Sep 2019

It's a same error of DLL load failed

Khushu06 on 23 Sep 2019

To access the notebook, open this file in a browser: file:///C:/Users/Khushboo.Girotra/AppData/Roaming/jupyter/runtime/nbserver-13148-open.html Or copy and paste one of these URLs: http://localhost:8888/?token=ecaf07a435edebf1a26c758893d1dac7c4996693520529ff or http://127.0.0.1:8888/?token=ecaf07a435edebf1a26c758893d1dac7c4996693520529ff [W 22:08:54.472 NotebookApp] Notebook Documents/Analytics bootcamp/python_decision_trees/decision_trees/decision_trees.ipynb is not trusted [E 22:08:58.108 NotebookApp] Uncaught exception POST /api/sessions (::1) HTTPServerRequest(protocol='http', host='localhost:8888', method='POST', uri='/api/sessions', version='HTTP/1.1', remote_ip='::1') Traceback (most recent call last): File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\tornado\web.py", line 1699, in _execute result = await result File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 742, in run yielded = self.gen.throw(*exc_info) # type: ignore File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\notebook\services\sessions\handlers.py", line 72, in post type=mtype)) File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 735, in run value = future.result() File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 742, in run yielded = self.gen.throw(*exc_info) # type: ignore File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\notebook\services\sessions\sessionmanager.py", line 88, in create_session kernel_id = yield self.start_kernel_for_session(session_id, path, name, type, kernel_name) File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 735, in run value = future.result() File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 742, in run yielded = self.gen.throw(*exc_info) # type: ignore File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\notebook\services\sessions\sessionmanager.py", line 101, in start_kernel_for_session self.kernel_manager.start_kernel(path=kernel_path, kernel_name=kernel_name) File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 735, in run value = future.result() File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 209, in wrapper yielded = next(result) File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\notebook\services\kernels\kernelmanager.py", line 168, in start_kernel super(MappingKernelManager, self).start_kernel(**kwargs) File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\jupyter_client\multikernelmanager.py", line 110, in start_kernel km.start_kernel(**kwargs) File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\jupyter_client\manager.py", line 240, in start_kernel self.write_connection_file() File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\jupyter_client\connect.py", line 547, in write_connection_file kernel_name=self.kernel_name File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\jupyter_client\connect.py", line 212, in write_connection_file with secure_write(fname) as f: File "C:\Users\Khushboo.Girotra\anaconda3\lib\contextlib.py", line 112, in __enter__ return next(self.gen) File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\jupyter_client\connect.py", line 100, in secure_write win32_restrict_file_to_user(fname) File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\jupyter_client\connect.py", line 53, in win32_restrict_file_to_user import win32api ImportError: DLL load failed: The specified procedure could not be found. [W 22:08:58.140 NotebookApp] Unhandled error [E 22:08:58.140 NotebookApp] { "Content-Type": "application/json", "Accept": "application/json, text/javascript, */*; q=0.01", "X-Xsrftoken": "2|272e5111|35d3dd9abc94bc322626eb0226eb4688|1568606969", "X-Requested-With": "XMLHttpRequest", "Referer": "http://localhost:8888/notebooks/Documents/Analytics%20bootcamp/python_decision_trees/decision_trees/decision_trees.ipynb", "Accept-Language": "en-IN", "Accept-Encoding": "gzip, deflate", "User-Agent": "Mozilla/5.0 (Windows NT 10.0; WOW64; Trident/7.0; rv:11.0) like Gecko", "Host": "localhost:8888", "Content-Length": "163", "Connection": "Keep-Alive", "Cache-Control": "no-cache", "Cookie": "_xsrf=2|272e5111|35d3dd9abc94bc322626eb0226eb4688|1568606969; username-localhost-8890=\"2|1:0|10:1569241500|23:username-localhost-8890|44:NjhmYTcwN2UyOWU3NGZkN2EzNDg2NWNkYWRiYjAwM2M=|2dd0b3cbedd7aec9ddb5a5487f6431906a442b75380dd0587e1d1b3e9f5f7475\"; username-localhost-8889=\"2|1:0|10:1569253558|23:username-localhost-8889|44:Mjg4OTcwZjIyMzJiNDkzMDkwZmVhZGY1Mzk2MGIwMGQ=|16708bbdcf21858ebb05eb126eea8fd1d1d23a770dd78f4c00427469bfa17d3c\"; username-localhost-8888=\"2|1:0|10:1569256712|23:username-localhost-8888|44:YjZkM2JjZDAwZmEyNDllMWI0NThhNzg0OTQ1YTRjM2M=|4d33dac2a071434c20d5ed0e0320c827950ec822c40925d68aa42b936e1e39e7\"" } [E 22:08:58.155 NotebookApp] 500 POST /api/sessions (::1) 312.31ms referer=http://localhost:8888/notebooks/Documents/Analytics%20bootcamp/python_decision_trees/decision_trees/decision_trees.ipynb

Khushu06 on 23 Sep 2019

Thanks for the update. You'll need to figure out why import win32api is not working. There are a number of SO hits on this issue, some of which state that pip install pypiwin32 resolved the issue. I don't have access to a windows machine, so can't really help much more than this - sorry.

kevin-bates on 23 Sep 2019

👍4

Thanks for giving me the directions !

Khushu06 on 23 Sep 2019

Now it shows me the error of dead kernel. Kindly help on this

```(base) C:\Users\Khushboo.Girotra>jupyter notebook
[I 10:33:32.182 NotebookApp] Loading IPython parallel extension
[I 10:33:32.292 NotebookApp] JupyterLab extension loaded from C:\Users\Khushboo.Girotra\anaconda3\lib\site-packages\jupyterlab
[I 10:33:32.292 NotebookApp] JupyterLab application directory is C:\Users\Khushboo.Girotra\anaconda3\share\jupyter\lab
[I 10:33:32.297 NotebookApp] Serving notebooks from local directory: C:\Users\Khushboo.Girotra
[I 10:33:32.298 NotebookApp] The Jupyter Notebook is running at:
[I 10:33:32.299 NotebookApp] http://localhost:8888/?token=8e24cc355a607b399fedca623643ddf1b2ebb428f69c39bc
[I 10:33:32.300 NotebookApp] or http://127.0.0.1:8888/?token=8e24cc355a607b399fedca623643ddf1b2ebb428f69c39bc
[I 10:33:32.301 NotebookApp] Use Control-C to stop this server and shut down all kernels (twice to skip confirmation).
[C 10:33:32.755 NotebookApp]

To access the notebook, open this file in a browser:
    file:///C:/Users/Khushboo.Girotra/AppData/Roaming/jupyter/runtime/nbserver-8844-open.html
Or copy and paste one of these URLs:
    http://localhost:8888/?token=8e24cc355a607b399fedca623643ddf1b2ebb428f69c39bc
 or http://127.0.0.1:8888/?token=8e24cc355a607b399fedca623643ddf1b2ebb428f69c39bc

[W 10:33:50.064 NotebookApp] Notebook Documents/Analytics bootcamp/python_decision_trees/decision_trees/decision_trees.ipynb is not trusted
[I 10:33:53.885 NotebookApp] Kernel started: a869e91b-d19d-478e-b2a7-6fda11ce89f5
Traceback (most recent call last):
File "C:\Users\Khushboo.Girotra\lib\runpy.py", line 193, in _run_module_as_main
"__main__", mod_spec)
File "C:\Users\Khushboo.Girotra\lib\runpy.py", line 85, in _run_code
exec(code, run_globals)
File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\ipykernel_launcher.py", line 16, in
app.launch_new_instance()
File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\traitlets\config\application.py", line 657, in launch_instance
app.initialize(argv)
File "", line 2, in initialize
File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\traitlets\config\application.py", line 87, in catch_config_error
return method(app, args, *kwargs)
File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\ipykernelkernelapp.py", line 530, in initialize
self.write_connection_file()
File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\ipykernelkernelapp.py", line 227, in write_connection_file
iopub_port=self.iopub_port, control_port=self.control_port)
File "C:\Users\Khushboo.Girotra\lib\site-packagesjupyter_client\connect.py", line 212, in write_connection_file
with secure_write(fname) as f:
File "C:\Users\Khushboo.Girotra\lib\contextlib.py", line 112, in __enter__
return next(self.gen)
File "C:\Users\Khushboo.Girotra\lib\site-packagesjupyter_client\connect.py", line 100, in secure_write
win32_restrict_file_to_user(fname)
File "C:\Users\Khushboo.Girotra\lib\site-packagesjupyter_client\connect.py", line 53, in win32_restrict_file_to_user
import win32api
ImportError: DLL load failed: The specified procedure could not be found.
[I 10:33:59.591 NotebookApp] KernelRestarter: restarting kernel (1/5), keep random ports
[IPKernelApp] ERROR | Failed to load connection file: 'C:\Users\Khushboo.Girotra\AppData\Roaming\jupyter\runtime\kernel-a869e91b-d19d-478e-b2a7-6fda11ce89f5.json'
Traceback (most recent call last):
File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\ipykernelkernelapp.py", line 252, in init_connection_file
self.load_connection_file()
File "C:\Users\Khushboo.Girotra\lib\site-packagesjupyter_client\connect.py", line 569, in load_connection_file
info = json.load(f)
File "C:\Users\Khushboo.Girotra\lib\json__init__.py", line 296, in load
parse_constant=parse_constant, object_pairs_hook=object_pairs_hook, *kw)
File "C:\Users\Khushboo.Girotra\lib\json__init__.py", line 348, in loads
return _default_decoder.decode(s)
File "C:\Users\Khushboo.Girotra\lib\json\decoder.py", line 337, in decode
obj, end = self.raw_decode(s, idx=_w(s, 0).end())
File "C:\Users\Khushboo.Girotra\lib\json\decoder.py", line 355, in raw_decode
raise JSONDecodeError("Expecting value", s, err.value) from None
json.decoder.JSONDecodeError: Expecting value: line 1 column 1 (char 0)
[I 10:34:02.637 NotebookApp] KernelRestarter: restarting kernel (2/5), keep random ports
[IPKernelApp] ERROR | Failed to load connection file: 'C:\Users\Khushboo.Girotra\AppData\Roaming\jupyter\runtime\kernel-a869e91b-d19d-478e-b2a7-6fda11ce89f5.json'
Traceback (most recent call last):
File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\ipykernelkernelapp.py", line 252, in init_connection_file
self.load_connection_file()
File "C:\Users\Khushboo.Girotra\lib\site-packagesjupyter_client\connect.py", line 569, in load_connection_file
info = json.load(f)
File "C:\Users\Khushboo.Girotra\lib\json__init__.py", line 296, in load
parse_constant=parse_constant, object_pairs_hook=object_pairs_hook, *kw)
File "C:\Users\Khushboo.Girotra\lib\json__init__.py", line 348, in loads
return _default_decoder.decode(s)
File "C:\Users\Khushboo.Girotra\lib\json\decoder.py", line 337, in decode
obj, end = self.raw_decode(s, idx=_w(s, 0).end())
File "C:\Users\Khushboo.Girotra\lib\json\decoder.py", line 355, in raw_decode
raise JSONDecodeError("Expecting value", s, err.value) from None
json.decoder.JSONDecodeError: Expecting value: line 1 column 1 (char 0)
[I 10:34:05.668 NotebookApp] KernelRestarter: restarting kernel (3/5), keep random ports
[IPKernelApp] ERROR | Failed to load connection file: 'C:\Users\Khushboo.Girotra\AppData\Roaming\jupyter\runtime\kernel-a869e91b-d19d-478e-b2a7-6fda11ce89f5.json'
Traceback (most recent call last):
File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\ipykernelkernelapp.py", line 252, in init_connection_file
self.load_connection_file()
File "C:\Users\Khushboo.Girotra\lib\site-packagesjupyter_client\connect.py", line 569, in load_connection_file
info = json.load(f)
File "C:\Users\Khushboo.Girotra\lib\json__init__.py", line 296, in load
parse_constant=parse_constant, object_pairs_hook=object_pairs_hook, *kw)
File "C:\Users\Khushboo.Girotra\lib\json__init__.py", line 348, in loads
return _default_decoder.decode(s)
File "C:\Users\Khushboo.Girotra\lib\json\decoder.py", line 337, in decode
obj, end = self.raw_decode(s, idx=_w(s, 0).end())
File "C:\Users\Khushboo.Girotra\lib\json\decoder.py", line 355, in raw_decode
raise JSONDecodeError("Expecting value", s, err.value) from None
json.decoder.JSONDecodeError: Expecting value: line 1 column 1 (char 0)
[I 10:34:08.695 NotebookApp] KernelRestarter: restarting kernel (4/5), keep random ports
[IPKernelApp] ERROR | Failed to load connection file: 'C:\Users\Khushboo.Girotra\AppData\Roaming\jupyter\runtime\kernel-a869e91b-d19d-478e-b2a7-6fda11ce89f5.json'
Traceback (most recent call last):
File "C:\Users\Khushboo.Girotra\AppData\Roaming\Python\Python37\site-packages\ipykernelkernelapp.py", line 252, in init_connection_file
self.load_connection_file()
File "C:\Users\Khushboo.Girotra\lib\site-packagesjupyter_client\connect.py", line 569, in load_connection_file
info = json.load(f)
File "C:\Users\Khushboo.Girotra\lib\json__init__.py", line 296, in load
parse_constant=parse_constant, object_pairs_hook=object_pairs_hook, *kw)
File "C:\Users\Khushboo.Girotra\lib\json__init__.py", line 348, in loads
return _default_decoder.decode(s)
File "C:\Users\Khushboo.Girotra\lib\json\decoder.py", line 337, in decode
obj, end = self.raw_decode(s, idx=_w(s, 0).end())
File "C:\Users\Khushboo.Girotra\lib\json\decoder.py", line 355, in raw_decode
raise JSONDecodeError("Expecting value", s, err.value) from None
json.decoder.JSONDecodeError: Expecting value: line 1 column 1 (char 0)
[W 10:34:11.713 NotebookApp] KernelRestarter: restart failed
[W 10:34:11.714 NotebookApp] Kernel a869e91b-d19d-478e-b2a7-6fda11ce89f5 died, removing from map.
[W 10:34:54.178 NotebookApp] Timeout waiting for kernel_info reply from a869e91b-d19d-478e-b2a7-6fda11ce89f5
[E 10:34:54.181 NotebookApp] Error opening stream: HTTP 404: Not Found (Kernel does not exist: a869e91b-d19d-478e-b2a7-6fda11ce89f5)
[W 10:34:55.240 NotebookApp] 404 GET /api/kernels/a869e91b-d19d-478e-b2a7-6fda11ce89f5/channels?session_id=fe921aa3776f48e79b7232347f66318f (::1): Kernel does not exist: a869e91b-d19d-478e-b2a7-6fda11ce89f5
[W 10:34:55.286 NotebookApp] 404 GET /api/kernels/a869e91b-d19d-478e-b2a7-6fda11ce89f5/channels?session_id=fe921aa3776f48e79b7232347f66318f (::1) 46.89ms referer=None
[W 10:34:57.395 NotebookApp] Replacing stale connection: a869e91b-d19d-478e-b2a7-6fda11ce89f5:fe921aa3776f48e79b7232347f66318f```

Khushu06 on 24 Sep 2019

This is still the same issue, failed import of win32api. Did you try pip install pywin32 into the correct environment? Looks like you're hitting this issue: https://github.com/conda-forge/jupyter_client-feedstock/issues/29 (so at least you're not alone :smile:)

kevin-bates on 24 Sep 2019

I have installed pywin32 , what does correct environment mean here?

Khushu06 on 24 Sep 2019

How should I resolve it ? I tried a lot reading lot of stuffs on github and solving it, but nothing works out. Please help

Khushu06 on 24 Sep 2019

If you're dealing with virtual envs or conda environments, where you installed pywin32 matters. I would create a one line python script that imports win32api and get that python script to not throw ModuleNotFoundError.

import win32api

save into import_win32api.py. If you invoke python import_win32api.py in the same env as you run Notebook, you should get something like ModuleNotFoundError: No module named 'win32api'. You'll know things are better when that same invocation yields nothing (indicating the import statement worked).

Also focus on where your python command is coming from (and relative to your jupyter command). The multiple envs can be confusing.

((I had also referenced pypiwin32 before since that's what SO posts used, but try pywin32 as well.))

kevin-bates on 24 Sep 2019

I got this error when I run this :

(base) C:\Users\Khushboo.Girotra>python import_win32api.py
Traceback (most recent call last):
File "import_win32api.py", line 1, in
import win32api
ImportError: DLL load failed: The specified procedure could not be found.

Khushu06 on 24 Sep 2019

That's good actually. So now try to get pywin32 installed in such a way that the import statement succeeds.

kevin-bates on 24 Sep 2019

but how ? what's the other way

Khushu06 on 24 Sep 2019

Try conda install pywin32 if you are using conda.

jasongrout on 24 Sep 2019

👍23 🎉5 🚀3 ❤3

I did that , still showing the same error.

Khushu06 on 24 Sep 2019

2 days back everything was working fine. Suddenly dead kernel issue pops up

Khushu06 on 24 Sep 2019

ModuleNotFoundError: No module named 'win32api' . This is the error which I am getting now

Khushu06 on 24 Sep 2019

@minrk updated the dependencies in conda-forge earlier today. These instructions might help get you going: https://github.com/conda-forge/jupyter_client-feedstock#installing-jupyter_client

kevin-bates on 25 Sep 2019

👎2 👍1

Same problem [kernel error]
I've got this error

Traceback (most recent call last):
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\tornado\web.py", line 1699, in _execute
result = await result
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(exc_info) # type: ignore
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\notebook\services\sessions\handlers.py", line 72, in post
type=mtype))
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(exc_info) # type: ignore
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\notebook\services\sessions\sessionmanager.py", line 88, in create_session
kernel_id = yield self.start_kernel_for_session(session_id, path, name, type, kernel_name)
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(*exc_info) # type: ignore
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\notebook\services\sessions\sessionmanager.py", line 101, in start_kernel_for_session
self.kernel_manager.start_kernel(path=kernel_path, kernel_name=kernel_name)
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\tornado\gen.py", line 209, in wrapper
yielded = next(result)
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packages\notebook\serviceskernelskernelmanager.py", line 168, in start_kernel
super(MappingKernelManager, self).start_kernel(kwargs)
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packagesjupyter_client\multikernelmanager.py", line 110, in start_kernel
km.start_kernel(kwargs)
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packagesjupyter_client\manager.py", line 240, in start_kernel
self.write_connection_file()
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packagesjupyter_client\connect.py", line 547, in write_connection_file
kernel_name=self.kernel_name
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packagesjupyter_client\connect.py", line 212, in write_connection_file
with secure_write(fname) as f:
File "C:\Users\Lemuel\Anaconda3\lib\contextlib.py", line 112, in __enter__
return next(self.gen)
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packagesjupyter_client\connect.py", line 100, in secure_write
win32_restrict_file_to_user(fname)
File "C:\Users\Lemuel\AppData\Roaming\Python\Python37\site-packagesjupyter_client\connect.py", line 53, in win32_restrict_file_to_user
import win32api
ImportError: DLL load failed: %1 is not a valid Win32 application.

please help me. thanks

lemuelaspe on 30 Sep 2019

I try installing pip install pypiwin32 but when i run import win32api i got this error
Traceback (most recent call last): File "<stdin>", line 1, in <module> ImportError: DLL load failed: %1 is not a valid Win32 application.

lemuelaspe on 30 Sep 2019

Please try relative to pywin32. Since this is a conda env - you might be better off with conda install pywin32.

kevin-bates on 30 Sep 2019

🎉1 👍1

It wont worked. I will try to re-install anaconda3 then create env for tensorflow-gpu then retry the process on launching jupyter notebook, I will update you if i got same error. Thank you for your response sir.

I've been following this step on installing tensorflow-gpu for object_detection but i stack while running this command (tensorflow1) C:\tensorflow1\models\research\object_detection> jupyter notebook object_detection_tutorial.ipynb. This is the github repository that i followed on installing tensorflow-gpu.

lemuelaspe on 30 Sep 2019

https://github.com/EdjeElectronics/TensorFlow-Object-Detection-API-Tutorial-Train-Multiple-Objects-Windows-10#appendix-common-errors

lemuelaspe on 30 Sep 2019

Hello,

I got through the same error today (this is really annoying, especially because it also breaks vscode interactive window and all my kernels).

After checking, pywin32 had a release 15 days ago for the first time in one year. Downgrading in my environment make jupyter work again (but it is obviously not a fix) :
pip install --upgrade pywin32==224

Note that creating a new environment from scratch does not fix your problem : pip install jupyter reinstall pywin32==225 which is buggued and seems not to work on windows in its current state.

Galileo-Galilei on 1 Oct 2019

👍34 ❤13 🚀4

Thanks Galileo,

The downgrade fixes the issue.
Currently testing Tensorflow2 on conda and the first obstacle comes from this notebook complaint.

saasgasques on 1 Oct 2019

Runnig the postinstall from an elevated command prompt worked for me:

python Scripts/pywin32_postinstall.py -install

teklinp on 1 Oct 2019

👍2 ❤1

pip install --upgrade pywin32==224

This solved my problem.

komal-saleem on 3 Oct 2019

👍9 😄3 ❤1

Hello,

I got through the same error today (this is really annoying, especially because it also breaks vscode interactive window and all my kernels).

After checking, pywin32 had a release 15 days ago for the first time in one year. Downgrading in my environment make jupyter work again (but it is obviously not a fix) :
pip install --upgrade pywin32==224

Note that creating a new environment from scratch does not fix your problem : pip install jupyter reinstall pywin32==225 which is buggued and seems not to work on windows in its current state.

Same issue, fixed downgrading to pywin32==224. Thanks a lot!

GiulioAutel on 3 Oct 2019

👍2

Thank you, I fixed the problem when i reinstalled it. I think the problem
is i dont set the right path.

On Mon, Sep 30, 2019, 21:39 Kevin Bates notifications@github.com wrote:

Please try relative to pywin32. Since this is a conda env - you might be
better off with conda install pywin32.

—
You are receiving this because you commented.
Reply to this email directly, view it on GitHub
https://github.com/jupyter/notebook/issues/4909?email_source=notifications&email_token=AMZGCQFB4GBZUJ4O6W7EUCLQMH6R7A5CNFSM4IZJOUDKYY3PNVWWK3TUL52HS4DFVREXG43VMVBW63LNMVXHJKTDN5WW2ZLOORPWSZGOD75VLZY#issuecomment-536565223,
or mute the thread
https://github.com/notifications/unsubscribe-auth/AMZGCQFSQ4DWCDTKYOKHRV3QMH6R7ANCNFSM4IZJOUDA
.

lemuelaspe on 3 Oct 2019

I had the same issue and was resolved by running the anaconda navigator as administrator and launched jupyter

mosharafMS on 4 Oct 2019

Thanks big time Galileo-Galilei, downgrading pywin32 to 224 fixed the issue for me too. For my virtualenv, that is:
pipenv run pip install --upgrade pywin32==224
And ye, pywin32==225 was released 15 Sep, pretty much the time I updated a load of modules + when Jupyter broke, so it all makes sense now.

rbscholtus on 4 Oct 2019

👍2

Thanks, @Galileo-Galilei, downgrading pywin32 from 225 to 224 resolved every kernel issue I'm having (ir, python2, and python3). Like @rbscholtus said the new version of pywin32 broke Jupyter completly.

AdityaJakkam on 4 Oct 2019

Thanks a lot @Galileo-Galilei! This solved the issue for me too. As for the others, please note that if you have several conda virtual environments and you use them as a kernel in jupyter notebook. The process he mentioned needs to be repeated for each of them after activating them! So happy I got this working after 2 useless days

gloriamacia on 5 Oct 2019

👍1

Try conda install pywin32 if you are using conda.

this solved it for me

ratnanil on 11 Oct 2019

@minrk updated the dependencies in conda-forge earlier today. These instructions might help get you going: https://github.com/conda-forge/jupyter_client-feedstock#installing-jupyter_client

This worked for me. Thanks a bunch.

sourcecode369 on 19 Oct 2019

Hello,

I got through the same error today (this is really annoying, especially because it also breaks vscode interactive window and all my kernels).

After checking, pywin32 had a release 15 days ago for the first time in one year. Downgrading in my environment make jupyter work again (but it is obviously not a fix) :
pip install --upgrade pywin32==224

Note that creating a new environment from scratch does not fix your problem : pip install jupyter reinstall pywin32==225 which is buggued and seems not to work on windows in its current state.

Thanks, confirming that downgrading solved the same issue for me as well.

daniellovett on 24 Oct 2019

Traceback (most recent call last): File "E:\Anaconda\lib\site-packages\tornado\web.py", line 1699, in _execute result = await result File "E:\Anaconda\lib\site-packages\tornado\gen.py", line 742, in run yielded = self.gen.throw(*exc_info) # type: ignore File "E:\Anaconda\lib\site-packages\notebook\services\sessions\handlers.py", line 72, in post type=mtype)) File "E:\Anaconda\lib\site-packages\tornado\gen.py", line 735, in run value = future.result() File "E:\Anaconda\lib\site-packages\tornado\gen.py", line 742, in run yielded = self.gen.throw(*exc_info) # type: ignore File "E:\Anaconda\lib\site-packages\notebook\services\sessions\sessionmanager.py", line 88, in create_session kernel_id = yield self.start_kernel_for_session(session_id, path, name, type, kernel_name) File "E:\Anaconda\lib\site-packages\tornado\gen.py", line 735, in run value = future.result() File "E:\Anaconda\lib\site-packages\tornado\gen.py", line 742, in run yielded = self.gen.throw(*exc_info) # type: ignore File "E:\Anaconda\lib\site-packages\notebook\services\sessions\sessionmanager.py", line 101, in start_kernel_for_session self.kernel_manager.start_kernel(path=kernel_path, kernel_name=kernel_name) File "E:\Anaconda\lib\site-packages\tornado\gen.py", line 735, in run value = future.result() File "E:\Anaconda\lib\site-packages\tornado\gen.py", line 209, in wrapper yielded = next(result) File "E:\Anaconda\lib\site-packages\notebook\services\kernels\kernelmanager.py", line 168, in start_kernel super(MappingKernelManager, self).start_kernel(**kwargs) File "E:\Anaconda\lib\site-packages\jupyter_client\multikernelmanager.py", line 110, in start_kernel km.start_kernel(**kwargs) File "E:\Anaconda\lib\site-packages\jupyter_client\manager.py", line 240, in start_kernel self.write_connection_file() File "E:\Anaconda\lib\site-packages\jupyter_client\connect.py", line 547, in write_connection_file kernel_name=self.kernel_name File "E:\Anaconda\lib\site-packages\jupyter_client\connect.py", line 212, in write_connection_file with secure_write(fname) as f: File "E:\Anaconda\lib\contextlib.py", line 112, in __enter__ return next(self.gen) File "E:\Anaconda\lib\site-packages\jupyter_client\connect.py", line 102, in secure_write with os.fdopen(os.open(fname, open_flag, 0o600), mode) as f: PermissionError: [Errno 13] Permission denied: 'C:\\Users\\Shivu\\AppData\\Roaming\\jupyter\\runtime\\kernel-a385ff0a-a21f-4f08-a75f-f22555578da2.json'

What can be the issue? Please help

Banashree96 on 25 Oct 2019

This is shown under kernel error. None of the notebooks are being Executed

Banashree96 on 25 Oct 2019

Please update jupyter_client and jupyter_core to their latest versions - 5.3.4 and 4.6.1 respectively. If that doesn't solve your issue, the error message produced has better diagnostics to help drive the exercise. Thanks.

kevin-bates on 25 Oct 2019

Had same issue and upgrading jupyter_client worked.

pip3 install --upgrade jupyter_client

bayoishola20 on 25 Oct 2019

👍1

Closing issue based on recent successes.

Using the latest versions of jupyter_client (>=5.3.4) and jupyter_core (>=4.6.1) should be attempted prior to opening a new issue. Thank you.

kevin-bates on 25 Oct 2019

👍1

I encountered this problem too but I wasn't using Anaconda. Turns out there's another step (it's in the pywin32 README):

Note that if you want to use pywin32 for "system wide" features, such as registering COM objects or implementing Windows Services, then you must run the following command from an elevated command prompt:
python Scripts/pywin32_postinstall.py -install

Hope this helps someone!

davystrong on 25 Oct 2019

❤3 👍3

$ pip3 install --upgrade pywin32==224 --force-reinstall
ERROR: Could not find a version that satisfies the requirement pywin32==224 (from versions: 225)
ERROR: No matching distribution found for pywin32==224

ralfhauser on 30 Oct 2019

I encountered this problem too but I wasn't using Anaconda. Turns out there's another step (it's in the pywin32 README):

Note that if you want to use pywin32 for "system wide" features, such as registering COM objects or implementing Windows Services, then you must run the following command from an elevated command prompt:
python Scripts/pywin32_postinstall.py -install

Hope this helps someone!

Thanks! It helped me with this problem having all updated versions of python and jupyter.

MeCrazyJunkie on 31 Oct 2019

Please try relative to pywin32. Since this is a conda env - you might be better off with conda install pywin32.

Thx, it worked for me

ZhentangHe on 7 Nov 2019

My system is Windows 64 bit. This solved for me.

conda install -c conda-forge pywin32
conda install -c anaconda jupyter_client
conda install -c conda-forge jupyter_core

pkumar-a on 8 Nov 2019

👍6

That didnt solve for me :(
I've already uninstalled and reinstalled using different options, nothing worked.
When I start Spyder the same error happens.
I already uninstalled, cleaned the registry, deleted anything I could find related to Anaconda, and reinstalled it, and the same error happens. It's very frustrating.

andreqts on 10 Nov 2019

Solved now! I had to uninstall and also delete the Python folder inside C:\Users[MY USER NAME]\AppData\Roaming before reinstalling. I also deleted everything related to Anaconda and Python in the disk and registry. Thank you anyway.

andreqts on 10 Nov 2019

My system is Windows 64 bit. This solved for me.

conda install -c conda-forge pywin32
conda install -c anaconda jupyter_client
conda install -c conda-forge jupyter_core

OMG bro you save me!
Thanks!

like5150 on 13 Nov 2019

👍4

pip install --upgrade pywin32==224
thank you very much,it work

42kun on 15 Nov 2019

👍9

(my_env) C:\Users\11576> pip install --upgrade pywin32==224 works for me
but there is one error when running it:

ERROR: Could not install packages due to an EnvironmentError: [WinError 5] Acess Denied:
'c:\users\11576\appdata\roaming\python\python37\site-packages\~in32\win32cred.pyd'
Consider using the --user option or check the permissions.

Anyway, it works

Chen0092 on 11 Dec 2019

Traceback (most recent call last):
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\web.py", line 1699, in _execute
result = await result
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(exc_info) # type: ignore
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\services\sessions\handlers.py", line 72, in post
type=mtype))
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(exc_info) # type: ignore
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\services\sessions\sessionmanager.py", line 88, in create_session
kernel_id = yield self.start_kernel_for_session(session_id, path, name, type, kernel_name)
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(*exc_info) # type: ignore
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\services\sessions\sessionmanager.py", line 101, in start_kernel_for_session
self.kernel_manager.start_kernel(path=kernel_path, kernel_name=kernel_name)
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 209, in wrapper
yielded = next(result)
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\serviceskernelskernelmanager.py", line 168, in start_kernel
super(MappingKernelManager, self).start_kernel(kwargs)
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\multikernelmanager.py", line 110, in start_kernel
km.start_kernel(kwargs)
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\manager.py", line 240, in start_kernel
self.write_connection_file()
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\connect.py", line 547, in write_connection_file
kernel_name=self.kernel_name
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\connect.py", line 212, in write_connection_file
with secure_write(fname) as f:
File "C:\Users\Toyosi\Anaconda3\lib\contextlib.py", line 112, in __enter__
return next(self.gen)
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\connect.py", line 102, in secure_write
with os.fdopen(os.open(fname, open_flag, 0o600), mode) as f:
PermissionError: [Errno 13] Permission denied: 'C:\Users\Toyosi\AppData\Roaming\jupyter\runtime\kernel-a98340e4-22b5-4437-b93a-d01839ee180e.json'

I'm new to anaconda and this is what my kernel error says
could someone help me fix it
i've tried all the solutions, uninstalled and installed, but none worked.

Toyosie on 24 Dec 2019

👀1

I'm sorry,I don't konw:(

------------------ 原始邮件 ------------------
发件人: "Toyosie"<[email protected]>;
发送时间: 2019年12月24日(星期二) 上午8:19
收件人: "jupyter/notebook"<[email protected]>;
抄送: "Kun"<[email protected]>; "Comment"<[email protected]>;
主题: Re: [jupyter/notebook] Kernel error in jupyter notebook (#4909)

Traceback (most recent call last):
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\web.py", line 1699, in _execute
result = await result
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(exc_info) # type: ignore
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\services\sessions\handlers.py", line 72, in post
type=mtype))
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(exc_info) # type: ignore
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\services\sessions\sessionmanager.py", line 88, in create_session
kernel_id = yield self.start_kernel_for_session(session_id, path, name, type, kernel_name)
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(*exc_info) # type: ignore
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\services\sessions\sessionmanager.py", line 101, in start_kernel_for_session
self.kernel_manager.start_kernel(path=kernel_path, kernel_name=kernel_name)
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 209, in wrapper
yielded = next(result)
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\serviceskernelskernelmanager.py", line 168, in start_kernel
super(MappingKernelManager, self).start_kernel(kwargs)
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\multikernelmanager.py", line 110, in start_kernel
km.start_kernel(kwargs)
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\manager.py", line 240, in start_kernel
self.write_connection_file()
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\connect.py", line 547, in write_connection_file
kernel_name=self.kernel_name
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\connect.py", line 212, in write_connection_file
with secure_write(fname) as f:
File "C:\Users\Toyosi\Anaconda3\lib\contextlib.py", line 112, in enter
return next(self.gen)
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\connect.py", line 102, in secure_write
with os.fdopen(os.open(fname, open_flag, 0o600), mode) as f:
PermissionError: [Errno 13] Permission denied: 'C:\Users\Toyosi\AppData\Roamingjupyter\runtimekernel-a98340e4-22b5-4437-b93a-d01839ee180e.json'

I'm new to anaconda and this is what my kernel error says
could someone help me fix it
i've tried all the solutions, uninstalled and installed, but none worked.

—
You are receiving this because you commented.
Reply to this email directly, view it on GitHub, or unsubscribe.

42kun on 28 Dec 2019

Hello,

I got through the same error today (this is really annoying, especially because it also breaks vscode interactive window and all my kernels).

After checking, pywin32 had a release 15 days ago for the first time in one year. Downgrading in my environment make jupyter work again (but it is obviously not a fix) :
pip install --upgrade pywin32==224

Note that creating a new environment from scratch does not fix your problem : pip install jupyter reinstall pywin32==225 which is buggued and seems not to work on windows in its current state.

Thank you, solved to me too. my actual pywin32 ver is 227, downgrading solved the problem.

Regards

philipesantos136 on 30 Dec 2019

👍1

Traceback (most recent call last):
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\web.py", line 1699, in _execute
result = await result
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(exc_info) # type: ignore
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\services\sessions\handlers.py", line 72, in post
type=mtype))
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(exc_info) # type: ignore
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\services\sessions\sessionmanager.py", line 88, in create_session
kernel_id = yield self.start_kernel_for_session(session_id, path, name, type, kernel_name)
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
yielded = self.gen.throw(*exc_info) # type: ignore
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\services\sessions\sessionmanager.py", line 101, in start_kernel_for_session
self.kernel_manager.start_kernel(path=kernel_path, kernel_name=kernel_name)
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
value = future.result()
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\tornado\gen.py", line 209, in wrapper
yielded = next(result)
File "C:\Users\Toyosi\Anaconda3\lib\site-packages\notebook\serviceskernelskernelmanager.py", line 168, in start_kernel
super(MappingKernelManager, self).start_kernel(kwargs)
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\multikernelmanager.py", line 110, in start_kernel
km.start_kernel(kwargs)
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\manager.py", line 240, in start_kernel
self.write_connection_file()
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\connect.py", line 547, in write_connection_file
kernel_name=self.kernel_name
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\connect.py", line 212, in write_connection_file
with secure_write(fname) as f:
File "C:\Users\Toyosi\Anaconda3\lib\contextlib.py", line 112, in enter
return next(self.gen)
File "C:\Users\Toyosi\Anaconda3\lib\site-packagesjupyter_client\connect.py", line 102, in secure_write
with os.fdopen(os.open(fname, open_flag, 0o600), mode) as f:
PermissionError: [Errno 13] Permission denied: 'C:\Users\Toyosi\AppData\Roamingjupyter\runtimekernel-a98340e4-22b5-4437-b93a-d01839ee180e.json'

I'm new to anaconda and this is what my kernel error says
could someone help me fix it
i've tried all the solutions, uninstalled and installed, but none worked.

Thats happend to me when i instaled Anaconda for the first Time, i just clicked on next, next, next and close, at the end of the process, boom, nothing works.

Your Anaconda installed on directory do not permit the scripts running correctly, try to create new folder on local disc (c:) called Anaconda3 or what you prefer and then install Anaconda inside that folder.

Remember to correctly unninstal older Anaconda before everything!

Regards

philipesantos136 on 30 Dec 2019

Closing issue based on recent successes.

Using the latest versions of jupyter_client (>=5.3.4) and jupyter_core (>=4.6.1) should be attempted prior to opening a new issue. Thank you.

I was facing the same issue with jupyter-client==5.3.4, jupyter_core==4.6.1, and pywin32==227. Running pip install --upgrade pywin32==224 --force-reinstall then fixed the issue for me.

nickderobertis on 23 Jan 2020

👍3 🚀1 ❤1 🎉1

`(base) C:\Users\NANI>jupyter notebook
[I 18:18:49.117 NotebookApp] JupyterLab extension loaded from C:\Users\NANI\Anaconda3\lib\site-packagesjupyterlab
[I 18:18:49.117 NotebookApp] JupyterLab application directory is C:\Users\NANI\Anaconda3\sharejupyter\lab
[I 18:18:49.129 NotebookApp] Serving notebooks from local directory: C:\Users\NANI
[I 18:18:49.129 NotebookApp] The Jupyter Notebook is running at:
[I 18:18:49.137 NotebookApp] http://localhost:8888/?token=ba3023afa0109fa2b443f9a40f8382f9f68feb5c3998531e
[I 18:18:49.137 NotebookApp] or http://127.0.0.1:8888/?token=ba3023afa0109fa2b443f9a40f8382f9f68feb5c3998531e
[I 18:18:49.141 NotebookApp] Use Control-C to stop this server and shut down all kernels (twice to skip confirmation).
[C 18:18:49.301 NotebookApp]

To access the notebook, open this file in a browser:
    file:///C:/Users/NANI/AppData/Roaming/jupyter/runtime/nbserver-17600-open.html
Or copy and paste one of these URLs:
    http://localhost:8888/?token=ba3023afa0109fa2b443f9a40f8382f9f68feb5c3998531e
 or http://127.0.0.1:8888/?token=ba3023afa0109fa2b443f9a40f8382f9f68feb5c3998531e

[I 18:19:20.751 NotebookApp] 302 GET /?token=ba3023afa0109fa2b443f9a40f8382f9f68feb5c3998531e (127.0.0.1) 0.00ms
[I 18:19:31.952 NotebookApp] Kernel started: be9cf94a-d4a0-4de5-b352-c33d499ce5bd
Traceback (most recent call last):
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 193, in _run_module_as_main
"__main__", mod_spec)
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 85, in _run_code
exec(code, run_globals)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel_launcher.py", line 16, in
app.launch_new_instance()
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 663, in launch_instance
app.initialize(argv)
File "", line 2, in initialize
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 87, in catch_config_error
return method(app, args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 542, in initialize
self.init_kernel()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 447, in init_kernel
user_ns=self.user_ns,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\ipkernel.py", line 67, in __init__
kernel = self,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 693, in __init__
self.init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\zmqshell.py", line 593, in init_magics
super(ZMQInteractiveShell, self).init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 2246, in init_magics
m.PylabMagics, m.ScriptMagics,
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magic.py", line 405, in register
m = m(shell=self.shell)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magics\osm.py", line 52, in __init__
self.execre = re.compile(r'(.).(%s)$' % winext,re.IGNORECASE)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 234, in compile
return _compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 286, in _compile
p = sre_compile.compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_compile.py", line 764, in compile
p = sre_parse.parse(p, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 930, in parse
p = _parse_sub(source, pattern, flags & SRE_FLAG_VERBOSE, 0)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 816, in _parse
p = _parse_sub(source, state, sub_verbose, nested + 1)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 507, in _parse
code = _escape(source, this, state)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 369, in _escape
raise source.error("incomplete escape %s" % escape, len(escape))
re.error: incomplete escape \U at position 52
[I 18:19:34.914 NotebookApp] KernelRestarter: restarting kernel (1/5), new random ports
Traceback (most recent call last):
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 193, in _run_module_as_main
"__main__", mod_spec)
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 85, in _run_code
exec(code, run_globals)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel_launcher.py", line 16, in
app.launch_new_instance()
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 663, in launch_instance
app.initialize(argv)
File "", line 2, in initialize
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 87, in catch_config_error
return method(app, *args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 542, in initialize
self.init_kernel()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 447, in init_kernel
user_ns=self.user_ns,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\ipkernel.py", line 67, in __init__
kernel = self,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 693, in __init__
self.init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\zmqshell.py", line 593, in init_magics
super(ZMQInteractiveShell, self).init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 2246, in init_magics
m.PylabMagics, m.ScriptMagics,
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magic.py", line 405, in register
m = m(shell=self.shell)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magics\osm.py", line 52, in __init__
self.execre = re.compile(r'(.).(%s)$' % winext,re.IGNORECASE)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 234, in compile
return _compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 286, in _compile
p = sre_compile.compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_compile.py", line 764, in compile
p = sre_parse.parse(p, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 930, in parse
p = _parse_sub(source, pattern, flags & SRE_FLAG_VERBOSE, 0)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 816, in _parse
p = _parse_sub(source, state, sub_verbose, nested + 1)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 507, in _parse
code = _escape(source, this, state)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 369, in _escape
raise source.error("incomplete escape %s" % escape, len(escape))
re.error: incomplete escape \U at position 52
[I 18:19:37.931 NotebookApp] KernelRestarter: restarting kernel (2/5), new random ports
Traceback (most recent call last):
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 193, in _run_module_as_main
"__main__", mod_spec)
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 85, in _run_code
exec(code, run_globals)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel_launcher.py", line 16, in
app.launch_new_instance()
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 663, in launch_instance
app.initialize(argv)
File "", line 2, in initialize
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 87, in catch_config_error
return method(app, *args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 542, in initialize
self.init_kernel()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 447, in init_kernel
user_ns=self.user_ns,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\ipkernel.py", line 67, in __init__
kernel = self,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 693, in __init__
self.init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\zmqshell.py", line 593, in init_magics
super(ZMQInteractiveShell, self).init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 2246, in init_magics
m.PylabMagics, m.ScriptMagics,
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magic.py", line 405, in register
m = m(shell=self.shell)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magics\osm.py", line 52, in __init__
self.execre = re.compile(r'(.).(%s)$' % winext,re.IGNORECASE)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 234, in compile
return _compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 286, in _compile
p = sre_compile.compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_compile.py", line 764, in compile
p = sre_parse.parse(p, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 930, in parse
p = _parse_sub(source, pattern, flags & SRE_FLAG_VERBOSE, 0)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 816, in _parse
p = _parse_sub(source, state, sub_verbose, nested + 1)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 507, in _parse
code = _escape(source, this, state)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 369, in _escape
raise source.error("incomplete escape %s" % escape, len(escape))
re.error: incomplete escape \U at position 52
[I 18:19:40.960 NotebookApp] KernelRestarter: restarting kernel (3/5), new random ports
Traceback (most recent call last):
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 193, in _run_module_as_main
"__main__", mod_spec)
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 85, in _run_code
exec(code, run_globals)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel_launcher.py", line 16, in
app.launch_new_instance()
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 663, in launch_instance
app.initialize(argv)
File "", line 2, in initialize
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 87, in catch_config_error
return method(app, *args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 542, in initialize
self.init_kernel()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 447, in init_kernel
user_ns=self.user_ns,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\ipkernel.py", line 67, in __init__
kernel = self,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 693, in __init__
self.init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\zmqshell.py", line 593, in init_magics
super(ZMQInteractiveShell, self).init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 2246, in init_magics
m.PylabMagics, m.ScriptMagics,
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magic.py", line 405, in register
m = m(shell=self.shell)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magics\osm.py", line 52, in __init__
self.execre = re.compile(r'(.).(%s)$' % winext,re.IGNORECASE)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 234, in compile
return _compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 286, in _compile
p = sre_compile.compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_compile.py", line 764, in compile
p = sre_parse.parse(p, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 930, in parse
p = _parse_sub(source, pattern, flags & SRE_FLAG_VERBOSE, 0)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 816, in _parse
p = _parse_sub(source, state, sub_verbose, nested + 1)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 507, in _parse
code = _escape(source, this, state)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 369, in _escape
raise source.error("incomplete escape %s" % escape, len(escape))
re.error: incomplete escape \U at position 52
[I 18:19:43.976 NotebookApp] KernelRestarter: restarting kernel (4/5), new random ports
Traceback (most recent call last):
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 193, in _run_module_as_main
"__main__", mod_spec)
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 85, in _run_code
exec(code, run_globals)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel_launcher.py", line 16, in
app.launch_new_instance()
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 663, in launch_instance
app.initialize(argv)
File "", line 2, in initialize
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 87, in catch_config_error
return method(app, *args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 542, in initialize
self.init_kernel()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 447, in init_kernel
user_ns=self.user_ns,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\ipkernel.py", line 67, in __init__
kernel = self,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 693, in __init__
self.init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\zmqshell.py", line 593, in init_magics
super(ZMQInteractiveShell, self).init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 2246, in init_magics
m.PylabMagics, m.ScriptMagics,
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magic.py", line 405, in register
m = m(shell=self.shell)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magics\osm.py", line 52, in __init__
self.execre = re.compile(r'(.*).(%s)$' % winext,re.IGNORECASE)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 234, in compile
return _compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 286, in _compile
p = sre_compile.compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_compile.py", line 764, in compile
p = sre_parse.parse(p, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 930, in parse
p = _parse_sub(source, pattern, flags & SRE_FLAG_VERBOSE, 0)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 816, in _parse
p = _parse_sub(source, state, sub_verbose, nested + 1)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 507, in _parse
code = _escape(source, this, state)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 369, in _escape
raise source.error("incomplete escape %s" % escape, len(escape))
re.error: incomplete escape \U at position 52
[W 18:19:47.004 NotebookApp] KernelRestarter: restart failed
[W 18:19:47.004 NotebookApp] Kernel be9cf94a-d4a0-4de5-b352-c33d499ce5bd died, removing from map.
[W 18:20:32.022 NotebookApp] Timeout waiting for kernel_info reply from be9cf94a-d4a0-4de5-b352-c33d499ce5bd
[E 18:20:32.022 NotebookApp] Error opening stream: HTTP 404: Not Found (Kernel does not exist: be9cf94a-d4a0-4de5-b352-c33d499ce5bd)
[W 18:20:33.080 NotebookApp] 404 GET /api/kernels/be9cf94a-d4a0-4de5-b352-c33d499ce5bd/channels?session_id=2154bf90daec4baa9350a1f2374e8027 (127.0.0.1): Kernel does not exist: be9cf94a-d4a0-4de5-b352-c33d499ce5bd
[W 18:20:33.104 NotebookApp] 404 GET /api/kernels/be9cf94a-d4a0-4de5-b352-c33d499ce5bd/channels?session_id=2154bf90daec4baa9350a1f2374e8027 (127.0.0.1) 28.01ms referer=None
[W 18:20:35.133 NotebookApp] Replacing stale connection: be9cf94a-d4a0-4de5-b352-c33d499ce5bd:2154bf90daec4baa9350a1f2374e8027

`
this is the error i got when i open a file in jupyter notebook and kernel is not starting

nani-samireddy on 23 Feb 2020

help me, please

nani-samireddy on 23 Feb 2020

Hiii nani try installing and reinstalling anaconda and run as administrator. That should help.On 23 Feb 2020 1:52 pm, nani samireddy notifications@github.com wrote:`(base) C:\Users\NANI>jupyter notebook
[I 18:18:49.117 NotebookApp] JupyterLab extension loaded from C:\Users\NANI\Anaconda3\lib\site-packagesjupyterlab
[I 18:18:49.117 NotebookApp] JupyterLab application directory is C:\Users\NANI\Anaconda3\sharejupyter\lab
[I 18:18:49.129 NotebookApp] Serving notebooks from local directory: C:\Users\NANI
[I 18:18:49.129 NotebookApp] The Jupyter Notebook is running at:
[I 18:18:49.137 NotebookApp] http://localhost:8888/?token=ba3023afa0109fa2b443f9a40f8382f9f68feb5c3998531e
[I 18:18:49.137 NotebookApp] or http://127.0.0.1:8888/?token=ba3023afa0109fa2b443f9a40f8382f9f68feb5c3998531e
[I 18:18:49.141 NotebookApp] Use Control-C to stop this server and shut down all kernels (twice to skip confirmation).
[C 18:18:49.301 NotebookApp]
To access the notebook, open this file in a browser:
file:///C:/Users/NANI/AppData/Roaming/jupyter/runtime/nbserver-17600-open.html
Or copy and paste one of these URLs:
http://localhost:8888/?token=ba3023afa0109fa2b443f9a40f8382f9f68feb5c3998531e
or http://127.0.0.1:8888/?token=ba3023afa0109fa2b443f9a40f8382f9f68feb5c3998531e

[I 18:19:20.751 NotebookApp] 302 GET /?token=ba3023afa0109fa2b443f9a40f8382f9f68feb5c3998531e (127.0.0.1) 0.00ms
[I 18:19:31.952 NotebookApp] Kernel started: be9cf94a-d4a0-4de5-b352-c33d499ce5bd
Traceback (most recent call last):
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 193, in _run_module_as_main
"main", mod_spec)
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 85, in _run_code
exec(code, run_globals)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel_launcher.py", line 16, in
app.launch_new_instance()
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 663, in launch_instance
app.initialize(argv)
File "", line 2, in initialize
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 87, in catch_config_error
return method(app, args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 542, in initialize
self.init_kernel()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 447, in init_kernel
user_ns=self.user_ns,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\ipkernel.py", line 67, in init
kernel = self,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 693, in init
self.init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\zmqshell.py", line 593, in init_magics
super(ZMQInteractiveShell, self).init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 2246, in init_magics
m.PylabMagics, m.ScriptMagics,
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magic.py", line 405, in register
m = m(shell=self.shell)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magics\osm.py", line 52, in init
self.execre = re.compile(r'(.).(%s)$' % winext,re.IGNORECASE)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 234, in compile
return _compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 286, in _compile
p = sre_compile.compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_compile.py", line 764, in compile
p = sre_parse.parse(p, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 930, in parse
p = _parse_sub(source, pattern, flags & SRE_FLAG_VERBOSE, 0)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 816, in _parse
p = _parse_sub(source, state, sub_verbose, nested + 1)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 507, in _parse
code = _escape(source, this, state)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 369, in _escape
raise source.error("incomplete escape %s" % escape, len(escape))
re.error: incomplete escape \U at position 52
[I 18:19:34.914 NotebookApp] KernelRestarter: restarting kernel (1/5), new random ports
Traceback (most recent call last):
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 193, in _run_module_as_main
"main", mod_spec)
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 85, in _run_code
exec(code, run_globals)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel_launcher.py", line 16, in
app.launch_new_instance()
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 663, in launch_instance
app.initialize(argv)
File "", line 2, in initialize
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 87, in catch_config_error
return method(app, *args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 542, in initialize
self.init_kernel()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 447, in init_kernel
user_ns=self.user_ns,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\ipkernel.py", line 67, in init
kernel = self,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 693, in init
self.init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\zmqshell.py", line 593, in init_magics
super(ZMQInteractiveShell, self).init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 2246, in init_magics
m.PylabMagics, m.ScriptMagics,
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magic.py", line 405, in register
m = m(shell=self.shell)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magics\osm.py", line 52, in init
self.execre = re.compile(r'(.).(%s)$' % winext,re.IGNORECASE)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 234, in compile
return _compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 286, in _compile
p = sre_compile.compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_compile.py", line 764, in compile
p = sre_parse.parse(p, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 930, in parse
p = _parse_sub(source, pattern, flags & SRE_FLAG_VERBOSE, 0)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 816, in _parse
p = _parse_sub(source, state, sub_verbose, nested + 1)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 507, in _parse
code = _escape(source, this, state)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 369, in _escape
raise source.error("incomplete escape %s" % escape, len(escape))
re.error: incomplete escape \U at position 52
[I 18:19:37.931 NotebookApp] KernelRestarter: restarting kernel (2/5), new random ports
Traceback (most recent call last):
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 193, in _run_module_as_main
"main", mod_spec)
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 85, in _run_code
exec(code, run_globals)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel_launcher.py", line 16, in
app.launch_new_instance()
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 663, in launch_instance
app.initialize(argv)
File "", line 2, in initialize
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 87, in catch_config_error
return method(app, *args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 542, in initialize
self.init_kernel()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 447, in init_kernel
user_ns=self.user_ns,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\ipkernel.py", line 67, in init
kernel = self,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 693, in init
self.init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\zmqshell.py", line 593, in init_magics
super(ZMQInteractiveShell, self).init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 2246, in init_magics
m.PylabMagics, m.ScriptMagics,
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magic.py", line 405, in register
m = m(shell=self.shell)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magics\osm.py", line 52, in init
self.execre = re.compile(r'(.).(%s)$' % winext,re.IGNORECASE)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 234, in compile
return _compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 286, in _compile
p = sre_compile.compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_compile.py", line 764, in compile
p = sre_parse.parse(p, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 930, in parse
p = _parse_sub(source, pattern, flags & SRE_FLAG_VERBOSE, 0)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 816, in _parse
p = _parse_sub(source, state, sub_verbose, nested + 1)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 507, in _parse
code = _escape(source, this, state)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 369, in _escape
raise source.error("incomplete escape %s" % escape, len(escape))
re.error: incomplete escape \U at position 52
[I 18:19:40.960 NotebookApp] KernelRestarter: restarting kernel (3/5), new random ports
Traceback (most recent call last):
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 193, in _run_module_as_main
"main", mod_spec)
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 85, in _run_code
exec(code, run_globals)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel_launcher.py", line 16, in
app.launch_new_instance()
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 663, in launch_instance
app.initialize(argv)
File "", line 2, in initialize
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 87, in catch_config_error
return method(app, *args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 542, in initialize
self.init_kernel()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 447, in init_kernel
user_ns=self.user_ns,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\ipkernel.py", line 67, in init
kernel = self,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 693, in init
self.init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\zmqshell.py", line 593, in init_magics
super(ZMQInteractiveShell, self).init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 2246, in init_magics
m.PylabMagics, m.ScriptMagics,
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magic.py", line 405, in register
m = m(shell=self.shell)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magics\osm.py", line 52, in init
self.execre = re.compile(r'(.).(%s)$' % winext,re.IGNORECASE)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 234, in compile
return _compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 286, in _compile
p = sre_compile.compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_compile.py", line 764, in compile
p = sre_parse.parse(p, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 930, in parse
p = _parse_sub(source, pattern, flags & SRE_FLAG_VERBOSE, 0)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 816, in _parse
p = _parse_sub(source, state, sub_verbose, nested + 1)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 507, in _parse
code = _escape(source, this, state)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 369, in _escape
raise source.error("incomplete escape %s" % escape, len(escape))
re.error: incomplete escape \U at position 52
[I 18:19:43.976 NotebookApp] KernelRestarter: restarting kernel (4/5), new random ports
Traceback (most recent call last):
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 193, in _run_module_as_main
"main", mod_spec)
File "C:\Users\NANI\Anaconda3\lib\runpy.py", line 85, in _run_code
exec(code, run_globals)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel_launcher.py", line 16, in
app.launch_new_instance()
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 663, in launch_instance
app.initialize(argv)
File "", line 2, in initialize
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\application.py", line 87, in catch_config_error
return method(app, *args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 542, in initialize
self.init_kernel()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernelkernelapp.py", line 447, in init_kernel
user_ns=self.user_ns,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, *kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\ipkernel.py", line 67, in init
kernel = self,
File "C:\Users\NANI\Anaconda3\lib\site-packages\traitlets\config\configurable.py", line 412, in instance
inst = cls(args, **kwargs)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 693, in init
self.init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\ipykernel\zmqshell.py", line 593, in init_magics
super(ZMQInteractiveShell, self).init_magics()
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\interactiveshell.py", line 2246, in init_magics
m.PylabMagics, m.ScriptMagics,
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magic.py", line 405, in register
m = m(shell=self.shell)
File "C:\Users\NANI\Anaconda3\lib\site-packages\IPython\core\magics\osm.py", line 52, in init
self.execre = re.compile(r'(.).(%s)$' % winext,re.IGNORECASE)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 234, in compile
return _compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\re.py", line 286, in _compile
p = sre_compile.compile(pattern, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_compile.py", line 764, in compile
p = sre_parse.parse(p, flags)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 930, in parse
p = _parse_sub(source, pattern, flags & SRE_FLAG_VERBOSE, 0)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 816, in _parse
p = _parse_sub(source, state, sub_verbose, nested + 1)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 426, in _parse_sub
not nested and not items))
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 507, in _parse
code = _escape(source, this, state)
File "C:\Users\NANI\Anaconda3\lib\sre_parse.py", line 369, in _escape
raise source.error("incomplete escape %s" % escape, len(escape))
re.error: incomplete escape \U at position 52
[W 18:19:47.004 NotebookApp] KernelRestarter: restart failed
[W 18:19:47.004 NotebookApp] Kernel be9cf94a-d4a0-4de5-b352-c33d499ce5bd died, removing from map.
[W 18:20:32.022 NotebookApp] Timeout waiting for kernel_info reply from be9cf94a-d4a0-4de5-b352-c33d499ce5bd
[E 18:20:32.022 NotebookApp] Error opening stream: HTTP 404: Not Found (Kernel does not exist: be9cf94a-d4a0-4de5-b352-c33d499ce5bd)
[W 18:20:33.080 NotebookApp] 404 GET /api/kernels/be9cf94a-d4a0-4de5-b352-c33d499ce5bd/channels?session_id=2154bf90daec4baa9350a1f2374e8027 (127.0.0.1): Kernel does not exist: be9cf94a-d4a0-4de5-b352-c33d499ce5bd
[W 18:20:33.104 NotebookApp] 404 GET /api/kernels/be9cf94a-d4a0-4de5-b352-c33d499ce5bd/channels?session_id=2154bf90daec4baa9350a1f2374e8027 (127.0.0.1) 28.01ms referer=None
[W 18:20:35.133 NotebookApp] Replacing stale connection: be9cf94a-d4a0-4de5-b352-c33d499ce5bd:2154bf90daec4baa9350a1f2374e8027
`
this is the error i got when i open a file in jupyter notebook and kernel is not starting

—You are receiving this because you commented.Reply to this email directly, view it on GitHub, or unsubscribe.

Toyosie on 24 Feb 2020

I have reinstalled it 5 times no use of reinstalling
my friend said that it is a networking issue my pc is connecting to localhost how can I solve it.

nani-samireddy on 26 Feb 2020

@nani-samireddy - your traceback output strikes me as more to do with ipykernel and ipython than jupyter_client and jupyter_core issues - which was the original problem reported on this issue.

I would make sure you're running the latest versions of ipykernel and ipython.

Also, does your notebook start but you only see this issue upon execution of a cell? There's some aspect to this that I wonder if the issue is related to what's in the cell. I'm assuming that's not the case, but I need to ask if you're able to run some simple cells prior to the issue?

kevin-bates on 26 Feb 2020

@kevin-bates I am running latest versions of ipykernel and ipython.
and my notebook is starting but I am not able to execute a single line of code
Annotation 2020-02-26 222745

nani-samireddy on 26 Feb 2020

Googling led me to this Spyder issue - which implies it's probably not in Notebook itself. More googling led me to this IPython issue - which I believe is your scenario.

Please check the contents of your PATHEXT environment variable and ensure it only contains extension names (suffixes). This article might help how to go about that. Like the IPython issue, I suspect your PATHEXT has path names in it and that's where the invalid escape sequence of '\U' is coming from.

kevin-bates on 26 Feb 2020

Collecting pycocotools
Using cached pycocotools-2.0.0.tar.gz (1.5 MB)
Building wheels for collected packages: pycocotools
Building wheel for pycocotools (setup.py): started
Building wheel for pycocotools (setup.py): finished with status 'error'
Running setup.py clean for pycocotools
Failed to build pycocotools
Installing collected packages: pycocotools
Running setup.py install for pycocotools: started
Running setup.py install for pycocotools: finished with status 'error'
ERROR: Command errored out with exit status 1:
command: 'c:\programdata\anaconda3python.exe' -u -c 'import sys, setuptools, tokenize; sys.argv[0] = '"'"'C:\Users\admin\AppData\Local\Temp\pip-install-gbwkk1le\pycocotools\setup.py'"'"'; file='"'"'C:\Users\admin\AppData\Local\Temp\pip-install-gbwkk1le\pycocotools\setup.py'"'"';f=getattr(tokenize, '"'"'open'"'"', open)(file);code=f.read().replace('"'"'\r\n'"'"', '"'"'\n'"'"');f.close();exec(compile(code, file, '"'"'exec'"'"'))' bdist_wheel -d 'C:\Users\admin\AppData\Local\Temp\pip-wheel-f2t8qhve'
cwd: C:\Users\admin\AppData\Local\Temp\pip-install-gbwkk1le\pycocotools
Complete output (13 lines):
running bdist_wheel
running build
running build_py
creating build
creating build\lib.win-amd64-3.7
creating build\lib.win-amd64-3.7\pycocotools
copying pycocotools\coco.py -> build\lib.win-amd64-3.7\pycocotools
copying pycocotools\cocoeval.py -> build\lib.win-amd64-3.7\pycocotools
copying pycocotools\mask.py -> build\lib.win-amd64-3.7\pycocotools
copying pycocotools_init_.py -> build\lib.win-amd64-3.7\pycocotools
running build_ext
building 'pycocotools._mask' extension
error: Microsoft Visual C++ 14.0 is required. Get it with "Build Tools for Visual Studio": https://visualstudio.microsoft.com/downloads/

Himani3344 on 6 Mar 2020

need help to solve above error

Himani3344 on 6 Mar 2020

[W 15:31:02.063 NotebookApp] Terminals not available (error was DLL load failed: %1 is not a valid Win32 application.)
[I 15:31:02.101 NotebookApp] JupyterLab extension loaded from C:\Users\nadia\Anaconda3\lib\site-packagesjupyterlab
[I 15:31:02.101 NotebookApp] JupyterLab application directory is C:\Users\nadia\Anaconda3\sharejupyter\lab
[I 15:31:02.103 NotebookApp] Serving notebooks from local directory: C:\Users\nadia
[I 15:31:02.103 NotebookApp] The Jupyter Notebook is running at:
[I 15:31:02.103 NotebookApp] http://localhost:8888/?token=5024d8db2d803fc4c0c3194677ddcb520230109fd1e9efa2
[I 15:31:02.103 NotebookApp] Use Control-C to stop this server and shut down all kernels (twice to skip confirmation).
[C 15:31:02.185 NotebookApp]

To access the notebook, open this file in a browser:
file:///C:/Users/nadia/AppData/Roaming/jupyter/runtime/nbserver-28920-open.html
Or copy and paste one of these URLs:
http://localhost:8888/?token=5024d8db2d803fc4c0c3194677ddcb520230109fd1e9efa2

I get this too

nadia238 on 9 Mar 2020

My system is Windows 64 bit. This solved for me.

conda install -c conda-forge pywin32
conda install -c anaconda jupyter_client
conda install -c conda-forge jupyter_core

Thank you so much!! this worked me!

sanjkn on 10 Mar 2020

👍5

Not able to get frozen inference graph module in notebook what will the error so that can get that module for object detection using tensorflow ??

Himani3344 on 11 Mar 2020

(tensorflow_gpu) c:\tensorflow\models\research\object_detection\builders>python model_builder_test.py
Traceback (most recent call last):
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\site-packages\tensorflowpython\pywrap_tensorflow.py", line 58, in
from tensorflow.python.pywrap_tensorflow_internal import *
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\site-packages\tensorflowpython\pywrap_tensorflow_internal.py", line 28, in
_pywrap_tensorflow_internal = swig_import_helper()
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\site-packages\tensorflowpython\pywrap_tensorflow_internal.py", line 24, in swig_import_helper
_mod = imp.load_module('_pywrap_tensorflow_internal', fp, pathname, description)
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\imp.py", line 243, in load_module
return load_dynamic(name, filename, file)
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\imp.py", line 343, in load_dynamic
return _load(spec)
ImportError: DLL load failed: The specified module could not be found.

During handling of the above exception, another exception occurred:

Traceback (most recent call last):
File "model_builder_test.py", line 20, in
import tensorflow as tf
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\site-packages\tensorflow__init__.py", line 41, in
from tensorflow.python.tools import module_util as _module_util
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\site-packages\tensorflowpython__init__.py", line 50, in
from tensorflow.python import pywrap_tensorflow
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\site-packages\tensorflowpython\pywrap_tensorflow.py", line 69, in
raise ImportError(msg)
ImportError: Traceback (most recent call last):
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\site-packages\tensorflowpython\pywrap_tensorflow.py", line 58, in
from tensorflow.python.pywrap_tensorflow_internal import *
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\site-packages\tensorflowpython\pywrap_tensorflow_internal.py", line 28, in
_pywrap_tensorflow_internal = swig_import_helper()
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\site-packages\tensorflowpython\pywrap_tensorflow_internal.py", line 24, in swig_import_helper
_mod = imp.load_module('_pywrap_tensorflow_internal', fp, pathname, description)
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\imp.py", line 243, in load_module
return load_dynamic(name, filename, file)
File "C:\Users\admin\anaconda3\envs\tensorflow_gpu\lib\imp.py", line 343, in load_dynamic
return _load(spec)
ImportError: DLL load failed: The specified module could not be found.

Failed to load the native TensorFlow runtime.

See https://www.tensorflow.org/install/errors

for some common reasons and solutions. Include the entire stack trace
above this error message when asking for help.

(tensorflow_gpu) c:\tensorflow\models\research\object_detection\builders>

help me with issue ASAP please.....

Himani3344 on 15 Mar 2020

As best as I can tell, this module (ntsecuritycon) comes from the pywin32 package, so I would focus on ensuring its proper installation. You might try conda update -c conda-forge pywin32.

kevin-bates on 17 Mar 2020

I'm referring to the setup.py that's in the repository: https://github.com/jupyter/jupyter_client/blob/5.3.3/setup.py
This file isn't laid down during installation but it's what is used during jupyter_client's installation.

You might try pip install --upgrade jupyter_client. You should have pywin32 installed.

I had the same issue and It actually worked for me
seems like there it was craving for an update

Thank you

Gopalkataria on 28 Mar 2020

My system is Windows 64 bit. This solved for me.

conda install -c conda-forge pywin32
conda install -c anaconda jupyter_client
conda install -c conda-forge jupyter_core

Worked like a charm dude!

Yash5044 on 13 Apr 2020

Try conda install pywin32 if you are using conda.

thanks for this solution.

anugrahdputra on 16 Apr 2020

Collecting pycocotools
Using cached pycocotools-2.0.0.tar.gz (1.5 MB)
Building wheels for collected packages: pycocotools
Building wheel for pycocotools (setup.py): started
Building wheel for pycocotools (setup.py): finished with status 'error'
Running setup.py clean for pycocotools
Failed to build pycocotools
Installing collected packages: pycocotools
Running setup.py install for pycocotools: started
Running setup.py install for pycocotools: finished with status 'error'
ERROR: Command errored out with exit status 1:
command: 'c:\programdata\anaconda3python.exe' -u -c 'import sys, setuptools, tokenize; sys.argv[0] = '"'"'C:\Users\admin\AppData\Local\Temp\pip-install-gbwkk1le\pycocotools\setup.py'"'"'; file='"'"'C:\Users\admin\AppData\Local\Temp\pip-install-gbwkk1le\pycocotools\setup.py'"'"';f=getattr(tokenize, '"'"'open'"'"', open)(file);code=f.read().replace('"'"'\r\n'"'"', '"'"'\n'"'"');f.close();exec(compile(code, file, '"'"'exec'"'"'))' bdist_wheel -d 'C:\Users\admin\AppData\Local\Temp\pip-wheel-f2t8qhve'
cwd: C:\Users\admin\AppData\Local\Temp\pip-install-gbwkk1le\pycocotools
Complete output (13 lines):
running bdist_wheel
running build
running build_py
creating build
creating build\lib.win-amd64-3.7
creating build\lib.win-amd64-3.7\pycocotools
copying pycocotools\coco.py -> build\lib.win-amd64-3.7\pycocotools
copying pycocotools\cocoeval.py -> build\lib.win-amd64-3.7\pycocotools
copying pycocotools\mask.py -> build\lib.win-amd64-3.7\pycocotools
copying pycocotools_init_.py -> build\lib.win-amd64-3.7\pycocotools
running build_ext
building 'pycocotools._mask' extension
error: Microsoft Visual C++ 14.0 is required. Get it with "Build Tools for Visual Studio": https://visualstudio.microsoft.com/downloads/

DID U GET THE SOLUTION FOR THIS ERROR?? EVEN IM STUCK WITH THIS ERROR

vinilcariappa on 18 Apr 2020

@Himani3344 - did you resolve the pycocotools issue?

This output seems unrelated to the discussion - which is focused on an issue relative to pywin32. There are infinite ways a "Kernel error in jupyter notebook" can rear its head - so you might be better off creating a new issue specific to a failure with pycocotools.

kevin-bates on 18 Apr 2020

after pip install --upgrade jupyter_client works fine for me

spazmantiz on 19 Apr 2020

Solved for me

conda install pywin32
installs :

certifi-2020.4.5.1 | py38_0 156 KB
pywin32-227 | py38he774522_1 5.6 MB

conda install jupyter_client
installs :

package | build
---------------------------|-----------------
decorator-4.4.2 | py_0 14 KB
entrypoints-0.3 | py38_0 11 KB
ipython_genutils-0.2.0 | py38_0 40 KB
jupyter_client-6.1.2 | py_0 82 KB
jupyter_core-4.6.3 | py38_0 98 KB
libsodium-1.0.16 | h9d3ae62_0 416 KB
pyzmq-18.1.1 | py38ha925a31_0 407 KB
traitlets-4.3.3 | py38_0 138 KB
zeromq-4.3.1 | h33f27b4_3 10.6 MB
------------------------------------------------------------

Version: 1.44.2 (system setup)
Commit: ff915844119ce9485abfe8aa9076ec76b5300ddd
Date: 2020-04-16T16:36:23.138Z
Electron: 7.1.11
Chrome: 78.0.3904.130
Node.js: 12.8.1
V8: 7.8.279.23-electron.0
OS: Windows_NT x64 10.0.18363
Python extension version 2020.3.71659 (2 April 2020)

Fixes this issue raised by win32api

Jupyter.log

import win32api
ImportError: DLL load failed while importing win32api: The specified module could not be found.
[W 16:56:16.502 NotebookApp] Unhandled error

wridhdhi on 21 Apr 2020

pywin32==225

but I get this error
ERROR: Could not install packages due to an EnvironmentError: [WinError 5] Access is denied: 'C:\Users\Nishant\AppData\Local\Temp\pip-uninstall-0dcy_q_8\win32\win32api.pyd'
Consider using the --user option or check the permissions.

nishantsingh23pbt on 16 Jun 2020

Sir My laptop is ASUS X510U . I've installed Anaconda and i opened jupyter notebook but it is showing Connection failed
Screenshot (277)

Sir i hope you could resolve the issue Asap.

Rudhirbabu on 22 Jun 2020

I am facing Kernel Error and code is not running. It is moving to next cell when I click run. Plz help.

Traceback (most recent call last):
File "C:\Users\USER\anaconda3\lib\site-packages\tornado\web.py", line 1703, in _execute
    result = await result
  File "C:\Users\USER\anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
    yielded = self.gen.throw(*exc_info)  # type: ignore
  File "C:\Users\USER\anaconda3\lib\site-packages\notebook\services\sessions\handlers.py", line 69, in post
    model = yield maybe_future(
  File "C:\Users\USER\anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
    value = future.result()
  File "C:\Users\USER\anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
    yielded = self.gen.throw(*exc_info)  # type: ignore
  File "C:\Users\USER\anaconda3\lib\site-packages\notebook\services\sessions\sessionmanager.py", line 88, in create_session
    kernel_id = yield self.start_kernel_for_session(session_id, path, name, type, kernel_name)
  File "C:\Users\USER\anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
    value = future.result()
  File "C:\Users\USER\anaconda3\lib\site-packages\tornado\gen.py", line 742, in run
    yielded = self.gen.throw(*exc_info)  # type: ignore
  File "C:\Users\USER\anaconda3\lib\site-packages\notebook\services\sessions\sessionmanager.py", line 100, in start_kernel_for_session
    kernel_id = yield maybe_future(
  File "C:\Users\USER\anaconda3\lib\site-packages\tornado\gen.py", line 735, in run
    value = future.result()
  File "C:\Users\USER\anaconda3\lib\site-packages\tornado\gen.py", line 209, in wrapper
    yielded = next(result)
  File "C:\Users\USER\anaconda3\lib\site-packages\notebook\services\kernels\kernelmanager.py", line 168, in start_kernel
    super(MappingKernelManager, self).start_kernel(**kwargs)
  File "C:\Users\USER\anaconda3\lib\site-packages\jupyter_client\multikernelmanager.py", line 186, in start_kernel
    km.start_kernel(**kwargs)
  File "C:\Users\USER\anaconda3\lib\site-packages\jupyter_client\manager.py", line 308, in start_kernel
    self.kernel = self._launch_kernel(kernel_cmd, **kw)
  File "C:\Users\USER\anaconda3\lib\site-packages\jupyter_client\manager.py", line 215, in _launch_kernel
    return launch_kernel(kernel_cmd, **kw)
  File "C:\Users\USER\anaconda3\lib\site-packages\jupyter_client\launcher.py", line 135, in launch_kernel
    proc = Popen(cmd, **kwargs)
  File "C:\Users\USER\anaconda3\lib\subprocess.py", line 854, in __init__
    self._execute_child(args, executable, preexec_fn, close_fds,
  File "C:\Users\USER\anaconda3\lib\subprocess.py", line 1307, in _execute_child
    hp, ht, pid, tid = _winapi.CreateProcess(executable, args,
FileNotFoundError: [WinError 2] The system cannot find the file specified

Faizul314 on 3 Aug 2020

You might try taking a look at https://github.com/jupyter/notebook/issues/2301#issuecomment-287119893 and the surrounding comments/instructions.

kevin-bates on 3 Aug 2020

step 2 command :- "conda activate (location of your env folder)"
step 3 command: - "python -m ipykernel install --user"

works

claudiopb on 14 Aug 2020

conda install pywin32 resolved the issue for me

samy-n on 16 Aug 2020

conda install pywin32

This worked for me like a charm

anuragk15 on 16 Aug 2020

@kevin-bates
I'm running latest version.
And the notebook is starting but I'm not able to execute anything I tried like 2+3 also but nothing is going.
And kernel is not starting..

nani-samireddy on 18 Sep 2020

hi @nani-samireddy - I'm assuming this latest issue is related to your this issue you amended at about the same time: https://github.com/jupyter/notebook/issues/2990#issuecomment-694896087

kevin-bates on 18 Sep 2020

@kevin-bates

If codes are not visible then you can use your desktop or laptop for better visualization.
Here is commands that are used in the video..!!
step 2 command :- "conda activate (location of your env folder)"
step 3 command: - "python -m ipykernel install --user"

claudiopb on 25 Sep 2020

👍1

Notebook: Kernel error in jupyter notebook

Most helpful comment

All 93 comments

Solved for me

Fixes this issue raised by win32api

Related issues